KIAA0247 (SUSD6) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KIAA0247 antibody: synthetic peptide directed towards the N terminal of human KIAA0247. Synthetic peptide located within the following region: YLCAEGYMLKGDYKYLTCKNGEWKPAMEISCRLNEDKDTHTSLGVPTLSI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	sushi domain containing 6
Database Link	NP_055549 Entrez Gene 9766 Human UniProt ID Q92537
Background	KIAA0247 is a single-pass type I membrane protein. It contains 1 Sushi (CCP/SCR) domain.The function ofThe KIAA0247 protein remains unknown.
Synonyms	DRAGO; KIAA0247
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.