PCDHA4 Rabbit Polyclonal Antibody

CAT#: TA341926

Rabbit Polyclonal Anti-PCDHA4 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human protocadherin alpha 4 (PCDHA4), transcript variant 2, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of protocadherin alpha 4 (PCDHA4), transcript variant 2
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PCDHA4 antibody: synthetic peptide directed towards the C terminal of human PCDHA4. Synthetic peptide located within the following region: SGYNAWLSYELQPETASASIPFRVGLYTGEISTTRALDETDAPRQRLLVL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 99 kDa
Gene Name protocadherin alpha 4
Background This gene is a member ofThe protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters.The alpha gene cluster is composed of 15 cadherin superfamily genes related toThe mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences.The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes inThe cluster.The large, uninterrupted N-terminal exons each encode six cadherin ectodomains whileThe C-terminal exons encodeThe cytoplasmic domain.These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role inThe establishment and function of specific cell-cell connections inThe brain. Alternative splicing has been observed and additional variants have been suggested butTheir full-length nature has yet to be determined. [provided by RefSeq, Jul 2008]
Synonyms CNR1; CNRN1; CRNR1; PCDH-ALPHA4
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%
Reference Data
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...