Myoferlin (MYOF) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FER1L3 antibody: synthetic peptide directed towards the C terminal of human FER1L3. Synthetic peptide located within the following region: QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	235 kDa
Gene Name	myoferlin
Database Link	NP_038479 Entrez Gene 26509 Human UniProt ID Q9NZM1
Background	Mutations in dysferlin, a protein associated withThe plasma membrane, can cause muscle weakness that affects both proximal and distal muscles.The protein encoded byThis gene is a type II membrane protein that is structurally similar to dysferlin. It is a member ofThe ferlin family and associates with both plasma and nuclear membranes.The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Two transcript variants encoding different isoforms have been found forThis gene. Other possible variants have been detected, butTheir full-length nature has not been determined. [provided by RefSeq, Dec 2008]
Synonyms	FER1L3
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%; Bovine: 86%; Zebrafish: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.