BACE1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-BACE1 antibody: synthetic peptide directed towards the N terminal of human BACE1. Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	beta-secretase 1
Database Link	NP_036236 Entrez Gene 23821 MouseEntrez Gene 23621 Human UniProt ID P56817
Background	Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which isThe protein encoded byThis gene.The encoded protein, a member ofThe peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly inThe Golgi. Multiple transcript variants encoding different isoforms have been described forThis gene. [provided by RefSeq, May 2011]
Synonyms	ASP2; BACE; HSPC104
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 91%
Reference Data
Protein Families	Druggable Genome, Protease, Transmembrane
Protein Pathways	Alzheimer's disease

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.