UGT1A4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-UGT1A4 antibody: synthetic peptide directed towards the N terminal of human UGT1A4. Synthetic peptide located within the following region: VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	UDP glucuronosyltransferase family 1 member A4
Database Link	NP_009051 Entrez Gene 54657 Human UniProt ID P22310
Background	This gene encodes a UDP-glucuronosyltransferase, an enzyme ofThe glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites.This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases.The locus includes thirteen unique alternate first exons followed by four common exons. Four ofThe alternate first exons are considered pseudogenes. Each ofThe remaining nine 5' exons may be spliced toThe four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodesThe substrate binding site, and is regulated by its own promoter.This enzyme has some glucuronidase activity towards bilirubin, although is is more active on amines, steroids, and sapogenins. [provided by RefSeq, Jul 2008]
Synonyms	HUG-BR2; UDPGT; UDPGT 1-4; UGT-1D; UGT1-04; UGT1.4; UGT1A4S; UGT1D
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Androgen and estrogen metabolism, Ascorbate and aldarate metabolism, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Pentose and glucuronate interconversions, Porphyrin and chlorophyll metabolism, Retinol metabolism, Starch and sucrose metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.