BVES Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-BVES antibody: synthetic peptide directed towards the middle region of human BVES. Synthetic peptide located within the following region: YLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	blood vessel epicardial substance
Database Link	NP_009004 Entrez Gene 11149 Human UniProt ID Q8NE79
Background	This gene encodes a member ofThe POP family of proteins containing three putative transmembrane domains.This gene is expressed in cardiac and skeletal muscle and may play an important role in development ofThese tissues.The mouse ortholog may be involved inThe regeneration of adult skeletal muscle and may act as a cell adhesion molecule in coronary vasculogenesis. Three transcript variants encodingThe same protein have been found forThis gene. [provided by RefSeq, Dec 2010]
Synonyms	HBVES; LGMD2X; POP1; POPDC1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%; Yeast: 82%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.