Melanoma gp100 (PMEL) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SILV antibody: synthetic peptide directed towards the N terminal of human SILV. Synthetic peptide located within the following region: HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	70 kDa
Gene Name	premelanosome protein
Database Link	NP_008859 Entrez Gene 6490 Human UniProt ID P40967
Background	This gene encodes a melanocyte-specific type I transmembrane glycoprotein.The encoded protein is enriched in melanosomes, which areThe melanin-producing organelles in melanocytes, and plays an essential role inThe structural organization of premelanosomes.This protein is involved in generating internal matrix fibers that defineThe transition from Stage I to Stage II melanosomes.This protein undergoes a complex pattern of prosttranslational processing and modification that is essential toThe proper functioning ofThe protein. A secreted form ofThis protein that is released by proteolytic ectodomain shedding may be used as a melanoma-specific serum marker. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2011]
Synonyms	D12S53E; gp100; ME20; ME20-M; ME20M; P1; P100; PMEL17; SI; SIL; SILV
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Goat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Rabbit: 86%
Reference Data
Protein Families	Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.