KDELR3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KDELR3 antibody: synthetic peptide directed towards the middle region of human KDELR3. Synthetic peptide located within the following region: AYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	KDEL endoplasmic reticulum protein retention receptor 3
Database Link	NP_006846 Entrez Gene 11015 Human UniProt ID O43731
Background	This gene encodes a member ofThe KDEL endoplasmic reticulum protein retention receptor family. Retention of resident soluble proteins inThe lumen ofThe endoplasmic reticulum (ER) is achieved in both yeast and animal cells byTheir continual retrieval fromThe cis-Golgi, or a pre-Golgi compartment. Sorting ofThese proteins is dependent on a C-terminal tetrapeptide signal, usually lys-asp-glu-leu (KDEL) in animal cells, and his-asp-glu-leu (HDEL) in S. cerevisiae.This process is mediated by a receptor that recognizes, and bindsThe tetrapeptide-containing protein, and returns it toThe ER. In yeast,The sorting receptor encoded by a single gene, ERD2, is a seven-transmembrane protein. Unlike yeast, several human homologs ofThe ERD2 gene, constitutingThe KDEL receptor gene family, have been described. KDELR3 wasThe third member ofThe family to be identified. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Synonyms	ERD2L3
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Guinea pig: 93%; Mouse: 92%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Vibrio cholerae infection

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.