Corin Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Corin antibody is: synthetic peptide directed towards the C-terminal region of Mouse Corin. Synthetic peptide located within the following region: MGNKMPFKLQEGEVRIIPLEQCQSYFDMKTITNRMICAGYESGTVDSCMG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	123 kDa
Gene Name	corin
Database Link	NP_058565 Entrez Gene 53419 Mouse UniProt ID Q9Z319
Background	Corin is a Serine-type endopeptidase involved in atrial natriuretic peptide hormone (NPPA) processing. It converts through proteolytic cleavageThe non-functional propeptide NPPA intoThe active hormone,Thereby regulating blood pressure in heart and promoting natriuresis, diuresis and vasodilation. Proteolytic cleavage of pro-NPPA also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Corin also acts as a regulator of sodium reabsorption in kidney. May also process pro-NPPBThe B-type natriuretic peptide.
Synonyms	ATC2; CRN; Lrp4; MGC119742; pro-ANP-convertase; PRSC; TMPRSS10
Note	Immunogen Sequence Homology: Human: 100%; Zebrafish: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%; Mouse: 86%; Bovine: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.