Ahrr Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Ahrr antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: CLRGGPDLLDPKGTSGDREEEDQKHILRRSPGAWGQREMHKYSYGLETPV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	78 kDa
Gene Name	aryl-hydrocarbon receptor repressor
Database Link	NP_033774 Entrez Gene 11624 Mouse UniProt ID Q3U1U7
Background	Ahrr mediates dioxin toxicity and is involved in regulation of cell growth and differentiation. Ahrr repressesThe transcription activity of AHR by competing withThis transcription factor for heterodimer formation withThe ARNT and subsequently binding toThe xenobiotic response element (XRE) sequence present inThe promoter regulatory region of variety of genes. Ahrr represses CYP1A1 by bindingThe XRE sequence and recruiting ANKRA2, HDAC4 and/or HDAC5. Autoregulates its expression by associating with its own XRE site.
Synonyms	AHH; AHHR; bHLHe77; KIAA1234; MGC167813; MGC176630
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.