Tcea2 Rabbit Polyclonal Antibody
CAT#: TA341818
Rabbit Polyclonal Anti-Tcea2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 7,106.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Tcea2 antibody: synthetic peptide directed towards the middle region of mouse Tcea2. Synthetic peptide located within the following region: KDASRTTDLSCKKPDPPRTPSTPRITTFPQVPITCDAVRNKCREMLTLAL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 34 |
Gene Name | transcription elongation factor A (SII), 2 |
Database Link | |
Background | Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites.The arresting sites in DNA haveThe property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage ofThe nascent transcript by S-II allowsThe resumption of elongation fromThe new 3'-terminus. |
Synonyms | OTTHUMP00000031638; TFIIS |
Note | Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Horse: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |