Tcea2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Tcea2 antibody: synthetic peptide directed towards the middle region of mouse Tcea2. Synthetic peptide located within the following region: KDASRTTDLSCKKPDPPRTPSTPRITTFPQVPITCDAVRNKCREMLTLAL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34
Gene Name	transcription elongation factor A (SII), 2
Database Link	NP_033352 Entrez Gene 21400 Mouse UniProt ID Q9QVN7
Background	Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites.The arresting sites in DNA haveThe property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage ofThe nascent transcript by S-II allowsThe resumption of elongation fromThe new 3'-terminus.
Synonyms	OTTHUMP00000031638; TFIIS
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Horse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.