Tcea2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Tcea2 antibody is: synthetic peptide directed towards the middle region of Rat Tcea2. Synthetic peptide located within the following region: SVNALRKQSSDEELIALAKSLIKSWKKLLDVSDGKSRDQGRGTPLPTSSS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	transcription elongation factor A (SII), 2
Database Link	NP_033352 Entrez Gene 29575 Rat UniProt ID Q9QVN7
Background	SII class transcription elongation factor; releases RNA polmerase II ternary complexes from transcriptional arrest at arresting sites; necessary for RNA polymerase II transcription elongation [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: D12927.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS160522, ERS160537 [ECO:0000348] ##Evidence-Data-END##
Synonyms	OTTHUMP00000031638; TFIIS
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.