Ascl2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ASCL2 antibody: synthetic peptide directed towards the C terminal of mouse ASCL2. Synthetic peptide located within the following region: PHGGANKKLSKVETLRSAVEYIRALQRLLAEHDAVRAALAGGLLTPATPP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	achaete-scute family bHLH transcription factor 2
Database Link	NP_032580 Entrez Gene 17173 Mouse UniProt ID O35885
Background	AS-C proteins are involved inThe determination ofThe neuronal precursors inThe peripheral nervous system andThe central nervous system.
Synonyms	ASH2; bHLHa45; HASH2; MASH2
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Pig: 92%; Bovine: 92%; Guinea pig: 86%; Dog: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.