FOXA3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Foxa3 antibody: synthetic peptide directed towards the c terminal of mouse Foxa3. Synthetic peptide located within the following region: YNFNHPFSINNLMSEQTSTPSKLDVGFGGYGAESGEPGVYYQSLYSRSLL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	forkhead box A3
Database Link	NP_004488 Entrez Gene 15377 Mouse UniProt ID P55318
Background	Foxa3 is a transcription factor that is thought to act as a 'pioneer' factor openingThe compacted chromatin for other proteins through interactions with nucleosomal core histones andThereby replacing linker histones at target enhancer and/or promoter sites. Foxa3 is originally described as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Foxa3 interacts withThe cis-acting regulatory regions ofThese genes.Foxa3 is involved in glucose homeostasis; activates GLUT2 transcription and regulation of neuronal-specific transcription. Foxa3 is also involved in regulation of spermatogenesis; required forThe maintenance ofThe testicular germ cell population and male fertility.
Synonyms	FKHH3; HNF3G; TCF3G
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Pig: 86%; Horse: 86%; Human: 86%; Bovine: 86%; Dog: 79%; Guinea pig: 79%
Reference Data
Protein Families	ES Cell Differentiation/IPS, Transcription Factors
Protein Pathways	Maturity onset diabetes of the young

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.