Foxd1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FOXD1 antibody: synthetic peptide directed towards the N terminal of mouse FOXD1. Synthetic peptide located within the following region: TGAGTGGGAKNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISSRFP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	forkhead box D1
Database Link	NP_032268 Entrez Gene 15229 Mouse UniProt ID Q61345
Background	FOXD1 belongs toThe forkhead family of transcription factors which is characterized by a distinct forkhead domain. FOXD1, specifically activateThe 1b promoter ofThe RI alpha gene in testicular Sertoli cells.
Synonyms	FKHL8; FREAC-4; FREAC4
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 81%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.