Foxb2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Foxb2 antibody: synthetic peptide directed towards the c terminal of mouse Foxb2. Synthetic peptide located within the following region: FGVPVKALCHSANQSLPAVPVPIKPTPALPPVTTLPPALSVPTASQQLPA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	forkhead box B2
Database Link	NP_032049 Entrez Gene 14240 Mouse UniProt ID Q64733
Background	Transcription factor.
Synonyms	bA159H20.4
Note	Immunogen Sequence Homology: Mouse: 100%; Rabbit: 85%; Bovine: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.