Foxd4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Foxd4 antibody: synthetic peptide directed towards the N terminal of mouse Foxd4. Synthetic peptide located within the following region: MNSARAGHLRSTPPPSPLSSDQDEVEIDVLAEEEDGDQTEEEDDEEESHK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	forkhead box D4
Database Link	NP_032048 Entrez Gene 14237 Mouse UniProt ID Q60688
Background	The function ofThis protein remains unknown.
Synonyms	FKHL9; FOXD4A; FREAC-5; FREAC5; MGC105106
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.