Etv2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Etv2 antibody: synthetic peptide directed towards the middle region of mouse Etv2. Synthetic peptide located within the following region: GHQSPAFTTPSKSNKQSDRATLTRYSKTNHRGPIQLWQFLLELLHDGARS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	ets variant 2
Database Link	NP_031985 Entrez Gene 14008 Mouse UniProt ID P41163
Background	Binds to DNA sequences containingThe consensus pentanucleotide 5'-CGGA[AT]-3'.
Synonyms	ER71; ETSRP71; MGC129834; MGC129835; OTTHUMP00000197799
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 92%; Bovine: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.