Cdx4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Cdx4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENTGGSVQSDSGS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	30 kDa
Gene Name	caudal type homeobox 4
Database Link	NP_031700 Entrez Gene 12592 Mouse UniProt ID Q07424
Background	The function ofThis protein remains unknown.
Synonyms	CDX4
Note	Immunogen Sequence Homology: Mouse: 100%; Pig: 93%; Rat: 93%; Human: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Horse: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.