ALX4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ALX4 antibody: synthetic peptide directed towards the N terminal of human ALX4. Synthetic peptide located within the following region: SSPFRAFPGGDKFGTTFLSAAAKAQGFGDAKSRARYGAGQQDLATPLESG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	ALX homeobox 4
Database Link	NP_068745 Entrez Gene 60529 Human UniProt ID Q9H161
Background	This gene encodes a paired-like homeodomain transcription factor expressed inThe mesenchyme of developing bones, limbs, hair, teeth, and mammary tissue. Mutations inThis gene cause parietal foramina 2 (PFM2); an autosomal dominant disease characterized by deficient ossification ofThe parietal bones. Mutations inThis gene also cause a form of frontonasal dysplasia with alopecia and hypogonadism; suggesting a role forThis gene in craniofacial development, mesenchymal-epithelial communication, and hair follicle development. Deletion of a segment of chromosome 11 containingThis gene, del(11)(p11p12), causes Potocki-Shaffer syndrome (PSS); a syndrome characterized by craniofacial anomalies, mental retardation, multiple exostoses, and genital abnormalities in males. In mouse,This gene has been shown to use dual translation initiation sites located 16 codons apart. [provided by RefSeq, Oct 2009]
Synonyms	CRS5; FND2
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rat: 91%; Rabbit: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.