Mycbp Rabbit Polyclonal Antibody
CAT#: TA341668
Rabbit Polyclonal Anti-Mycbp Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 7,106.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Mycbp antibody is: synthetic peptide directed towards the C-terminal region of Mouse Mycbp. Synthetic peptide located within the following region: HLGAATPENPEIELLRLELAEMKEKYEATVEENKKLKAKLVQYEPPQEEK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 12 kDa |
Gene Name | MYC binding protein |
Database Link | |
Background | May controlThe transcriptional activity of MYC. StimulatesThe activation of E box-dependent transcription by MYC. |
Synonyms | AMY-1; AMY1; FLJ41056 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |