Arg 3.1 (ARC) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ARC antibody: synthetic peptide directed towards the middle region of human ARC. Synthetic peptide located within the following region: ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	activity-regulated cytoskeleton-associated protein
Database Link	NP_056008 Entrez Gene 23237 Human UniProt ID Q7LC44
Background	ARC is required for consolidation of synaptic plasticity as well as formation of long-term memory. It regulates endocytosis of AMPA receptors in response to synaptic activity.The protein is also required for homeostatic synaptic scaling of AMPA receptors.
Synonyms	Arg3.1
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.