DDX26 (INTS6) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-INTS6 antibody: synthetic peptide directed towards the C terminal of human INTS6. Synthetic peptide located within the following region: GFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	99 kDa
Gene Name	integrator complex subunit 6
Database Link	NP_001035026 Entrez Gene 26512 Human UniProt ID Q9UL03
Background	DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.The protein encoded byThis gene is a DEAD box protein that is part of a complex that interacts withThe C-terminus of RNA polymerase II and is involved in 3' end processing of snRNAs. In addition,This gene is a candidate tumor suppressor and located inThe critical region of loss of heterozygosity (LOH). Three transcript variants encoding two different isoforms have been found forThis gene. [provided by RefSeq, Jul 2008]
Synonyms	DBI-1; DDX26; DDX26A; DICE1; HDB; INT6; Notchl2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.