DDX42 Rabbit Polyclonal Antibody
CAT#: TA341581
Rabbit Polyclonal Anti-DDX42 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 4,840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DDX42 antibody: synthetic peptide directed towards the N terminal of human DDX42. Synthetic peptide located within the following region: PLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYM |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 103 kDa |
Gene Name | DEAD-box helicase 42 |
Database Link | |
Background | This gene encodes a member ofThe Asp-Glu-Ala-Asp (DEAD) box protein family. Members ofThis protein family are putative RNA helicases, and are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Members ofThis family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. Two transcript variants encodingThe same protein have been identified forThis gene. [provided by RefSeq, Jul 2008] |
Synonyms | DDX42P; RHELP; RNAHP; SF3B8; SF3b125 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Pathways | Spliceosome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |