DDX42 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DDX42 antibody: synthetic peptide directed towards the N terminal of human DDX42. Synthetic peptide located within the following region: PLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	103 kDa
Gene Name	DEAD-box helicase 42
Database Link	NP_031398 Entrez Gene 11325 Human UniProt ID Q86XP3
Background	This gene encodes a member ofThe Asp-Glu-Ala-Asp (DEAD) box protein family. Members ofThis protein family are putative RNA helicases, and are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Members ofThis family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. Two transcript variants encodingThe same protein have been identified forThis gene. [provided by RefSeq, Jul 2008]
Synonyms	DDX42P; RHELP; RNAHP; SF3B8; SF3b125
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Pathways	Spliceosome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.