AKAP5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-AKAP5 antibody: synthetic peptide directed towards the middle region of human AKAP5. Synthetic peptide located within the following region: KQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	A-kinase anchoring protein 5
Database Link	NP_004848 Entrez Gene 9495 Human UniProt ID P24588
Background	The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which haveThe common function of binding toThe regulatory subunit of protein kinase A (PKA) and confiningThe holoenzyme to discrete locations withinThe cell.This gene encodes a member ofThe AKAP family.The encoded protein binds toThe RII-beta regulatory subunit of PKA, and also to protein kinase C andThe phosphatase calcineurin. It is predominantly expressed in cerebral cortex and may anchorThe PKA protein at postsynaptic densities (PSD) and be involved inThe regulation of postsynaptic events. It is also expressed in T lymphocytes and may function to inhibit interleukin-2 transcription by disrupting calcineurin-dependent dephosphorylation of NFAT. [provided by RefSeq, Jul 2008]
Synonyms	AKAP75; AKAP79; H21
Note	Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Yeast: 82%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.