ESX1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ESX1 antibody: synthetic peptide directed towards the N terminal of human ESX1. Synthetic peptide located within the following region: SLMARGGEDEENTRSKPEYGTEAENNVGTEGSVPSDDQDREGGGGHEPEQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	ESX homeobox 1
Database Link	NP_703149 Entrez Gene 80712 Human UniProt ID Q8N693
Background	This gene encodes a dual-function 65 kDa protein that undergoes proteolytic cleavage to produce a 45 kDa N-terminal fragment with a paired-like homeodomain and a 20 kDa C-terminal fragment with a proline-rich domain.The C-terminal fragment localizes toThe cytoplasm whileThe N-terminal fragment localizes exclusively toThe nucleus. In contrast to human,The mouse homolog has a novel PN/PF motif inThe C-terminus and is paternally imprinted in placental tissue.This gene likely plays a role in placental development and spermatogenesis. [provided by RefSeq, Jan 2010]
Synonyms	ESX1L; ESXR1
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.