Zfp27 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Zfp27 antibody is: synthetic peptide directed towards the middle region of Mouse Zfp27. Synthetic peptide located within the following region: HRRIHTGEKLYDCSHCGKGFSYNSDLRIHQKIHTGEKRHGCVDCGKAFTQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	93 kDa
Gene Name	zinc finger protein 27
Database Link	NP_001032796 Entrez Gene 22689 Mouse UniProt ID P10077
Background	May be involved in transcriptional regulation.
Synonyms	mkr-4; mszf76; Zfp-27
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 93%; Rat: 86%; Mouse: 86%; Rabbit: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.