SP140L Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SP140L antibody: synthetic peptide directed towards the middle region of human LOC93349. Synthetic peptide located within the following region: TVDFQAPLLPVTCGGVKGILHKEKLEQGTLAKCIQTEDGKWFTPMEFEIK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	SP140 nuclear body protein like
Database Link	NP_612411 Entrez Gene 93349 Human UniProt ID Q9H930
Background	Located on chromosome 2,The LOC93349 gene encodes a hypothetical protein with unknown function.
Synonyms	MGC132667
Note	Immunogen Sequence Homology: Human: 100%; Horse: 80%; Rat: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.