ZNF101 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF101 antibody: synthetic peptide directed towards the N terminal of human ZNF101. Synthetic peptide located within the following region: EWALLSPSQKNLYRDVTLETFRNLASVGIQWKDQDIENLYQNLGIKLRSL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	zinc finger protein 101
Database Link	NP_149981 Entrez Gene 94039 Human UniProt ID Q8IZC7
Background	Zinc finger proteins (ZNFs), such as ZNF101, bind nucleic acids and perform many key functions,The most important of which is regulating transcription (summary by Bellefroid et al., 1993 [PubMed 8467795]). See ZNF91 (MIM 603971) for general information on ZNFs. [supplied by OMIM, Nov 2010]. Transcript Variant:This variant (2) differs inThe 5' UTR, lacks a portion ofThe 5' coding region and initiates translation at a downstream start codon, compared to variant 1. It encodes isoform 2, which has a shorter N-terminus, compared to isoform 1. Sequence Note:This RefSeq record was created from transcript and genomic sequence data to makeThe sequence consistent withThe reference genome assembly.The genomic coordinates used forThe transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: DB264378.1, BI838075.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
Synonyms	HZF12
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.