PGBD1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PGBD1 antibody: synthetic peptide directed towards the N terminal of human PGBD1. Synthetic peptide located within the following region: YEALPGPAPENEDGLVKVKEEDPTWEQVCNSQEGSSHTQEICRLRFRHFC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	92 kDa
Gene Name	piggyBac transposable element derived 1
Database Link	NP_115896 Entrez Gene 84547 Human UniProt ID Q96JS3
Background	The piggyBac family of proteins, found in diverse animals, are transposases related toThe transposase ofThe canonical piggyBac transposon fromThe moth, Trichoplusia ni.This family also includes genes in several genomes, including human, that appear to have been derived fromThe piggyBac transposons.This gene belongs toThe subfamily of piggyBac transposable element derived (PGBD) genes.The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families.This gene product is specifically expressed inThe brain, however, its exact function is not known. Alternative splicing results in multiple transcript variants encodingThe same protein. [provided by RefSeq, May 2010]
Synonyms	dJ874C20.4; HUCEP-4; SCAND4
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Bovine: 92%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.