ZNF397 Rabbit Polyclonal Antibody
CAT#: TA341412
Rabbit Polyclonal Anti-ZNF397 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 3,080.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF397 antibody: synthetic peptide directed towards the middle region of human ZNF397. Synthetic peptide located within the following region: VQQHNPESGEEAVTLLEDLEREFDDPGQQVPASPQGPAVPWKDLTCLRAS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 61 kDa |
Gene Name | zinc finger protein 397 |
Database Link | |
Background | This gene encodes a protein with a N-terminal SCAN domain, andThe longer isoform contains nine C2H2-type zinc finger repeats inThe C-terminal domain.The protein localizes to centromeres during interphase and early prophase, and different isoforms can repress or activate transcription in transfection studies. Multiple transcript variants encoding different isoforms have been found forThis gene. Additional variants have been described, butTheir biological validity has not been determined. [provided by RefSeq, Oct 2009] |
Synonyms | ZNF47; ZSCAN15 |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%; Rat: 92%; Mouse: 92%; Dog: 75% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |