ZSCAN5 (ZSCAN5A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZSCAN5 antibody: synthetic peptide directed towards the middle region of human ZSCAN5. Synthetic peptide located within the following region: KPDASSISQEEPQGEATPVGNRESPGQAGMNSIHSPGPASPVSHPDGQEA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	zinc finger and SCAN domain containing 5A
Database Link	NP_077279 Entrez Gene 79149 Human UniProt ID Q9BUG6
Background	May be involved in transcriptional regulation.
Synonyms	ZNF495; ZSCAN5
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.