CSNK1A1L Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CSNK1A1L antibody: synthetic peptide directed towards the middle region of human CSNK1A1L. Synthetic peptide located within the following region: TLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	casein kinase 1 alpha 1 like
Database Link	NP_660204 Entrez Gene 122011 Human UniProt ID Q8N752
Background	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. CSNK1A1L participates in Wnt signaling.
Synonyms	CK1
Note	Immunogen Sequence Homology: Human: 100%; Zebrafish: 79%; Dog: 77%; Pig: 77%; Rat: 77%; Horse: 77%; Mouse: 77%; Guinea pig: 77%
Reference Data
Protein Families	Druggable Genome, Protein Kinase
Protein Pathways	Hedgehog signaling pathway, Wnt signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.