FAM82A1 (RMDN2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RMDN2 antibody: synthetic peptide directed towards the middle region of human RMDN2. Synthetic peptide located within the following region: WRFARAYGDMYELSTNTQEKKHYANIGKTLSERAINRAPMNGHCHLWYAV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	65 kDa
Gene Name	regulator of microtubule dynamics 2
Database Link	NP_653314 Entrez Gene 151393 Human UniProt ID Q96LZ7
Background	RMDN2 belongs to the FAM82/RMD family. It is a single-pass membrane protein. The function of the RMDN2 protein remains unknown.
Synonyms	BLOCK18; FAM82A; FAM82A1; PRO34163; PYST9371; RMD-2; RMD2; RMD4
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 92%; Guinea pig: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.