Rhebl1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Rhebl1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VEGEFLEGYDPTVENTYSKTVTLGKDEFHLHLVDTAGQDEYSILPYSLII
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	20 kDa
Gene Name	Ras homolog enriched in brain like 1
Database Link	NP_081243 Entrez Gene 69159 Mouse UniProt ID Q9D8T3
Background	Rhebl1 binds GTP and exhibits intrinsic GTPase activity. It may activate NF-kappa-B-mediated gene transcription. It promotes signal transduction through MTOR, activates RPS6KB1, and is a downstream target of the small GTPase-activating proteins TSC1 and TSC2.
Synonyms	FLJ25797; MGC34869; Rheb2; RhebL1c
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 83%; Sheep: 83%; Zebrafish: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.