ARL8A Rabbit Polyclonal Antibody
CAT#: TA340309
Rabbit Polyclonal Anti-ARL8A Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ARL8A antibody: synthetic peptide directed towards the middle region of human ARL8A. Synthetic peptide located within the following region: IGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 21 kDa |
Gene Name | ADP ribosylation factor like GTPase 8A |
Database Link | |
Background | ARL8A belongs to the small GTPase superfamily, Arf family. ARL8A m,ay play a role in lysosomes motility. Alternatively, may play a role in chromosomes segregation. |
Synonyms | ARL10B; GIE2 |
Note | Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Zebrafish: 93%; Guinea pig: 93%; Dog: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |