ARL11 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ARL11 antibody: synthetic peptide directed towards the middle region of human ARL11. Synthetic peptide located within the following region: WKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	21 kDa
Gene Name	ADP ribosylation factor like GTPase 11
Database Link	NP_612459 Entrez Gene 115761 Human UniProt ID Q969Q4
Background	ARL11 belongs to the small GTPase superfamily, Arf family. It may play a role in apoptosis and act as a tumor suppressor. Defects in ARL11 may be a cause of susceptibility to chronic lymphocytic leukemia (CLL).
Synonyms	ARLTS1
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.