C20orf141 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C20orf141 antibody: synthetic peptide directed towards the middle region of human C20orf141. Synthetic peptide located within the following region: RKLLTRGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALLLLLMGLGPLL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	17 kDa
Gene Name	chromosome 20 open reading frame 141
Database Link	NP_542777 Entrez Gene 128653 Human UniProt ID Q9NUB4
Background	C20orf141 is a single-pass membrane protein. The exact function of C20orf141 remains unknown.
Synonyms	dJ860F19.4
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.