AZIN2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ADC antibody: synthetic peptide directed towards the middle region of human ADC. Synthetic peptide located within the following region: RHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	antizyme inhibitor 2
Database Link	NP_443724 Entrez Gene 366473 RatEntrez Gene 113451 Human UniProt ID Q96A70
Background	ADC decarboxylates L-arginine to agmatine. Truncated splice isoforms probably lack activity.
Synonyms	ADC; AZI2; AZIB1; ODC-p; ODC1L; ODCp
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 86%; Dog: 79%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Arginine and proline metabolism, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.