CTRP7 (C1QTNF7) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C1QTNF7 antibody: synthetic peptide directed towards the middle region of human C1QTNF7. Synthetic peptide located within the following region: SIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	C1q and tumor necrosis factor related protein 7
Database Link	NP_114117 Entrez Gene 114905 Human UniProt ID Q9BXJ2
Background	The specific function of C1QTNF7 is not yet known.
Synonyms	CTRP7; ZACRP7
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 86%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.