FBXW10 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FBXW10 antibody: synthetic peptide directed towards the middle region of human FBXW10. Synthetic peptide located within the following region: RKIHLLDIIQVKAIPVEFRGHAGSVRALFLCEEENFLLSGSYDLSIRYWD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	120 kDa
Gene Name	F-box and WD repeat domain containing 10
Database Link	NP_113644 Entrez Gene 10517 Human UniProt ID Q5XX13
Background	Members of the F-box protein family, such as FBXW10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.Members of the F-box protein family, such as FBXW10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]). [supplied by OMIM]
Synonyms	Fbw10; HREP; SM2SH2; SM25H2
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Rat: 93%; Horse: 86%; Rabbit: 86%; Pig: 77%; Guinea pig: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.