Vps45 Rabbit Polyclonal Antibody
CAT#: TA340171
Rabbit Polyclonal Anti-Vps45 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Vps45 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Vps45. Synthetic peptide located within the following region: PFLHETLDHLIKGRLKENLYPYLGPSTLRDRPQDIIVFIIGGATYEEALT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 63 kDa |
Gene Name | vacuolar protein sorting 45 |
Database Link | |
Background | Vps45 may play a role in vesicle-mediated protein trafficking from the Golgi stack through the trans-Golgi network. |
Synonyms | h-vps45; H1; H1VPS45; hlVps45; VPS45A; VPS45B; VPS54A; VSP45; VSP45A |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 86%; Guinea pig: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |