EIF2B1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-EIF2B1 antibody: synthetic peptide directed towards the C terminal of human EIF2B1. Synthetic peptide located within the following region: ADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	eukaryotic translation initiation factor 2B subunit alpha
Database Link	NP_001405 Entrez Gene 1967 Human UniProt ID Q14232
Background	EIF2B1 belongs to the EIF-2B alpha/beta/delta subunits family. It catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. Defects in EIF2B1 are a cause of leukoencephalopathy with vanishing white matter (VWM).
Synonyms	EIF2B; EIF2BA
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Mouse: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Bovine: 79%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.