SLC47A2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SLC47A2 antibody: synthetic peptide directed towards the C terminal of human SLC47A2. Synthetic peptide located within the following region: TYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIRRGAALGAASATLMV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	61 kDa
Gene Name	solute carrier family 47 member 2
Database Link	NP_001093116 Entrez Gene 146802 Human UniProt ID Q86VL8
Background	SLC47A2 is a protein belonging to a family of transporters involved in excretion of toxic electrolytes, both endogenous and exogenous, through urine and bile. This transporter family shares homology with the bacterial MATE (multidrug and toxin extrusion) protein family responsible for drug resistance.This gene encodes a protein belonging to a family of transporters involved in excretion of toxic electrolytes, both endogenous and exogenous, through urine and bile. This transporter family shares homology with the bacterial MATE (multidrug and toxin extrusion) protein family responsible for drug resistance. This gene is one of two members of the MATE transporter family located near each other on chromosome 17. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
Synonyms	MATE2; MATE2-B; MATE2-K; MATE2K
Note	Immunogen Sequence Homology: Human: 100%; Dog: 85%; Horse: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.