RDM1 Rabbit Polyclonal Antibody

CAT#: TA339975

Rabbit Polyclonal Anti-RDM1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 50 ug

Product images

经常一起买 (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Transient overexpression lysate of RAD52 motif 1 (RDM1), transcript variant 1
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-RDM1 antibody: synthetic peptide directed towards the middle region of human RDM1. Synthetic peptide located within the following region: NSSKCQELANYYFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 26 kDa
Gene Name RAD52 motif containing 1
Background RDM1 is a protein involved in the cellular response to cisplatin, a drug commonly used in chemotherapy. It contains two motifs: a motif found in RAD52, a protein that functions in DNA double-strand breaks and homologous recombination, and an RNA recognition motif (RRM) that is not found in RAD52. The RAD52 motif region in RAD52 is important for protein function and may be involved in DNA binding or oligomerization.This gene encodes a protein involved in the cellular response to cisplatin, a drug commonly used in chemotherapy. The protein encoded by this gene contains two motifs: a motif found in RAD52, a protein that functions in DNA double-strand breaks and homologous recombination, and an RNA recognition motif (RRM) that is not found in RAD52. The RAD52 motif region in RAD52 is important for protein function and may be involved in DNA binding or oligomerization. Alternatively spliced transcript variants encoding different isoforms have been reported.
Synonyms RAD52B
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Rabbit: 93%; Guinea pig: 91%; Mouse: 83%; Bovine: 83%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...