GCOM1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Gcom1 antibody: synthetic peptide directed towards the middle region of human Gcom1. Synthetic peptide located within the following region: VAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	GRINL1A complex locus 1
Database Link	NP_001018101 Entrez Gene 145781 Human UniProt ID P0CAP1
Background	This gene (Gcom1) is part of a complex transcript unit that includes the gene for glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A (GRINL1A). Transcription of this gene occurs at an upstream promoter, with two different groups of alternatively spliced variants: Gup for GRINL1A upstream transcripts and Gcom for GRINL1A combined transcripts. The GRINL1A gene uses a downstream promoter for transcription and also has multiple alternatively spliced variants. This gene (Gcom1) is part of a complex transcript unit that includes the gene for glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A (GRINL1A). Transcription of this gene occurs at an upstream promoter, with two different groups of alternatively spliced variants: Gup for GRINL1A upstream transcripts and Gcom for GRINL1A combined transcripts. The GRINL1A gene uses a downstream promoter for transcription and also has multiple alternatively spliced variants.
Synonyms	gcom; Gcom2; GRINL1A; MYZAP; MYZAP-POLR2M
Note	Immunogen Sequence Homology: Human: 100%; Yeast: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 93%; Rabbit: 86%; Horse: 85%; Bovine: 85%; Dog: 77%; Zebrafish: 75%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.