MED25 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	10k-ChIP, WB
Recommend Dilution	WB, CHIP
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-MED25 antibody is: synthetic peptide directed towards the C-terminal region of Human MED25. Synthetic peptide located within the following region: PPLLHPPPAQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	mediator complex subunit 25
Database Link	NP_112235 Entrez Gene 81857 Human UniProt ID Q71SY5
Background	The function of this protein remains unknown.
Synonyms	ACID1; ARC92; CMT2B2; P78; PTOV2; TCBAP0758
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.