ZFP14 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZFP14 antibody: synthetic peptide directed towards the N terminal of human ZFP14. Synthetic peptide located within the following region: KSYSLQGSIFRNDWECKSKIEGEKEQQEGYFGQVKITSEKMTTYKRHNFL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	63 kDa
Gene Name	ZFP14 zinc finger protein
Database Link	NP_065968 Entrez Gene 57677 Human UniProt ID Q9HCL3
Background	ZFP14 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 13 C2H2-type zinc fingers and 1 KRAB domain. ZFP14 ay be involved in transcriptional regulation.
Synonyms	ZNF531
Note	Immunogen Sequence Homology: Human: 100%; Horse: 86%; Dog: 79%; Rat: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.