SIN3B Rabbit Polyclonal Antibody
CAT#: TA339717
Rabbit Polyclonal Anti-SIN3B Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SIN3B antibody: synthetic peptide directed towards the middle region of human SIN3B. Synthetic peptide located within the following region: LVSDDVCLKVVELYLNEKKRGAAGGNLSSRCVRAARETSYQWKAERCMAD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 133 kDa |
Gene Name | SIN3 transcription regulator family member B |
Database Link | |
Background | SIN3B acts as a transcriptional repressor. It interacts with MXI1 to repress MYC responsive genes and antagonize MYC oncogenic activities. Also, it interacts with MAD-MAX heterodimers by binding to MAD. The heterodimer then represses transcription by tethering SIN3B to DNA. The gene is also able to form a complex with FOXK1 which represses transcription |
Synonyms | KIAA0700 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 93%; Zebrafish: 92%; Mouse: 86%; Rat: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |