FIP200 (RB1CC1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RB1CC1 antibody: synthetic peptide directed towards the C terminal of human RB1CC1. Synthetic peptide located within the following region: SGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	183 kDa
Gene Name	RB1 inducible coiled-coil 1
Database Link	NP_001077086 Entrez Gene 9821 Human UniProt ID Q8TDY2
Background	RB1CC1 is implicated in the regulation of RB1 expression. It functions as a DNA-binding transcription factor. RB1CC1 is a potent regulator of the RB1 pathway and a mediator that plays a crucial role in muscular differentiation. The expression of RB1CC1 is, thus, a prerequisite for myogenic differentiation. RB1CC1 is frequently mutated in breast cancer and shows characteristics of a classical tumor suppressor gene.
Synonyms	ATG17; CC1; FIP200; PPP1R131
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.